PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_B3BC47BB0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 70aa    MW: 7977.19 Da    PI: 5.082
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_B3BC47BB0.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB135.51.5e-421701786
                  NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                           mkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy+eplk+y
  Traes_2AS_B3BC47BB0.1  1 MKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYMEPLKLY 70
                           9*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.0E-28170IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.0E-38170IPR009072Histone-fold
PfamPF008085.2E-22155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.4E-191937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.4E-193856No hitNo description
PRINTSPR006153.4E-195770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MKKALPANAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF  60
EDYMEPLKLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-341701887NF-YB
4awl_B1e-341701988NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-341701988NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027891e-111GU902789.1 Triticum monococcum nuclear transcription factor Y subunit B5 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562720.12e-46PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotO233107e-47NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLH9N7V41e-46H9N7V4_HORVU; NF-YB1
TrEMBLM0YM161e-46M0YM16_HORVD; Uncharacterized protein
TrEMBLW5BQ071e-46W5BQ07_WHEAT; Uncharacterized protein
STRINGMLOC_70684.14e-46(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-48nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]